PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV47386.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ARF
Protein Properties Length: 665aa    MW: 74283.1 Da    PI: 5.9405
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV47386.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.21.3e-22127227198
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f+k+lt sd++++g +++ +++a+++       +++    ++l+  d++g++W +++i+r++++r++lt+GW+ Fv+a++L +gD ++F   + +++el
  KZV47386.1 127 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVASDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSAKKLVAGDAFIFL--RGENGEL 221
                 99****************************964333..4459************************************************..449999* PP

                 EEEEE- CS
          B3  93 vvkvfr 98 
                 +v+v+r
  KZV47386.1 222 RVGVRR 227
                 ****97 PP

2Auxin_resp108.19.8e-36253334182
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 a ha+st++ F+v+Y+Pr+s+seFvv+++k+++  ++k+svGmRfkm+fe+e+++err+ Gt+vgv d+ ++ Wp+S+WrsL
  KZV47386.1 253 ALHAISTGTLFSVFYKPRTSRSEFVVSLNKYLEVRSQKLSVGMRFKMKFEGEEVPERRFNGTIVGVGDYPSSAWPDSEWRSL 334
                 689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.23E-43116256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.6E-40124242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.26E-20125227No hitNo description
SMARTSM010196.8E-21127229IPR003340B3 DNA binding domain
PROSITE profilePS5086311.265127229IPR003340B3 DNA binding domain
PfamPF023621.2E-20127227IPR003340B3 DNA binding domain
PfamPF065075.1E-33253334IPR010525Auxin response factor
PROSITE profilePS5174525.82542624IPR000270PB1 domain
PfamPF023092.8E-6544579IPR033389AUX/IAA domain
SuperFamilySSF542778.83E-12544620No hitNo description
PfamPF023098.7E-7584633IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MANLSANHFA GGPPPGGPSD ALYKELWHAC AGSLVTLPGK GERVYYFPQG HMEQLEASIH  60
QGLDQQLPIF NLPSKILCKV MNVTLQAEQE TDEVYAQITL MPEQDENAIT SPDPPLPEPQ  120
QCTVHSFCKT LTASDTSTHG GFSVLRRHAD DCLPPLDMSQ QPPWQELVAS DLHGNEWHFR  180
HIFRGQPRRH LLTTGWSVFV SAKKLVAGDA FIFLRGENGE LRVGVRRLMR QLNKMPSSVI  240
SSHSMHLGVL ATALHAISTG TLFSVFYKPR TSRSEFVVSL NKYLEVRSQK LSVGMRFKMK  300
FEGEEVPERR FNGTIVGVGD YPSSAWPDSE WRSLMVQWDE PSPILRPDRV SPWEIEPLVA  360
ATLPNSHAEQ RNKRIRPSVL PSPMQDLSSL GMWKSPLDSP AAFTCHDPLR RPDVYQSPKL  420
SSVTKNCTPS YNEKLLPLPS NSIYQSNIET AAESVTPPSD RRHGNGYRLF GIELVDHSTN  480
EANSLAVLTG AAVEDSHVSL DIQSEQQSEP LDHNPCNVPS LICDPDKSFL ISPHGPQDRK  540
IRSCTKVHMQ GIAVGRAVDL TRFDSYEDLF EKFEEMFEIV GELTGSEKKW QVVYTDDEDD  600
MMMVGDDPWH EFCTMAKKIY ICTAEEAKRL SPKIKLPLTE VKSSKLLSDT SIGAEEQSST  660
MGSAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B0.043581355Auxin response factor 1
4ldw_A0.043581355Auxin response factor 1
4ldv_A0.043581355Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087626.10.0PREDICTED: auxin response factor 1-like
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLA0A022R4X40.0A0A022R4X4_ERYGU; Auxin response factor
STRINGSolyc01g103050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA58381923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1